Anti ANKRD55 pAb (ATL-HPA061649)

Atlas Antibodies

Catalog No.:
ATL-HPA061649-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 55
Gene Name: ANKRD55
Alternative Gene Name: FLJ11795
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049985: 92%, ENSRNOG00000013555: 93%
Entrez Gene ID: 79722
Uniprot ID: Q3KP44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQATMDFSTPSVFDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSEGCTPLMHAVSGRQADTVKLLLKMGAN
Gene Sequence RQATMDFSTPSVFDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSEGCTPLMHAVSGRQADTVKLLLKMGAN
Gene ID - Mouse ENSMUSG00000049985
Gene ID - Rat ENSRNOG00000013555
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKRD55 pAb (ATL-HPA061649)
Datasheet Anti ANKRD55 pAb (ATL-HPA061649) Datasheet (External Link)
Vendor Page Anti ANKRD55 pAb (ATL-HPA061649) at Atlas Antibodies

Documents & Links for Anti ANKRD55 pAb (ATL-HPA061649)
Datasheet Anti ANKRD55 pAb (ATL-HPA061649) Datasheet (External Link)
Vendor Page Anti ANKRD55 pAb (ATL-HPA061649)
Citations for Anti ANKRD55 pAb (ATL-HPA061649) – 1 Found
Mena, Jorge; Alloza, Iraide; Tulloch Navarro, Raquel; Aldekoa, Ane; Díez García, Javier; Villanueva Etxebarria, Ane; Lindskog, Cecilia; Antigüedad, Alfredo; Boyero, Sabas; Mendibe-Bilbao, María Del Mar; Álvarez de Arcaya, Amaya; Sánchez Menoyo, José Luis; Midaglia, Luciana; Villarrubia, Noelia; Malhotra, Sunny; Montalban, Xavier; Villar, Luisa María; Comabella, Manuel; Vandenbroeck, Koen. Genomic Multiple Sclerosis Risk Variants Modulate the Expression of the ANKRD55-IL6ST Gene Region in Immature Dendritic Cells. Frontiers In Immunology. 12( 35111166):816930.  PubMed