Anti ANKRD54 pAb (ATL-HPA071287)

Atlas Antibodies

SKU:
ATL-HPA071287-25
  • Immunohistochemical staining of human colon shows moderate nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to microtubules & midbody.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 54
Gene Name: ANKRD54
Alternative Gene Name: LIAR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033055: 74%, ENSRNOG00000010821: 61%
Entrez Gene ID: 129138
Uniprot ID: Q6NXT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEP
Gene Sequence RSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEP
Gene ID - Mouse ENSMUSG00000033055
Gene ID - Rat ENSRNOG00000010821
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD54 pAb (ATL-HPA071287)
Datasheet Anti ANKRD54 pAb (ATL-HPA071287) Datasheet (External Link)
Vendor Page Anti ANKRD54 pAb (ATL-HPA071287) at Atlas Antibodies

Documents & Links for Anti ANKRD54 pAb (ATL-HPA071287)
Datasheet Anti ANKRD54 pAb (ATL-HPA071287) Datasheet (External Link)
Vendor Page Anti ANKRD54 pAb (ATL-HPA071287)