Anti ANKRD50 pAb (ATL-HPA044008 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044008-25
  • Immunohistochemistry analysis in human testis and liver tissues using HPA044008 antibody. Corresponding ANKRD50 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 50
Gene Name: ANKRD50
Alternative Gene Name: KIAA1223
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044864: 83%, ENSRNOG00000010534: 84%
Entrez Gene ID: 57182
Uniprot ID: Q9ULJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CKIMIPSAQQEIGRSQQQFLIHQQSGEQKKRNGIMTNPNYHLQSNQVFLGRVSVPRTMQDRGHQEVLEGYPSSETELSLKQALKLQIEGSDPSFN
Gene Sequence CKIMIPSAQQEIGRSQQQFLIHQQSGEQKKRNGIMTNPNYHLQSNQVFLGRVSVPRTMQDRGHQEVLEGYPSSETELSLKQALKLQIEGSDPSFN
Gene ID - Mouse ENSMUSG00000044864
Gene ID - Rat ENSRNOG00000010534
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ANKRD50 pAb (ATL-HPA044008 w/enhanced validation)
Datasheet Anti ANKRD50 pAb (ATL-HPA044008 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANKRD50 pAb (ATL-HPA044008 w/enhanced validation)