Anti ANKRD49 pAb (ATL-HPA040273)

Atlas Antibodies

SKU:
ATL-HPA040273-25
  • Immunohistochemical staining of human colon shows strong nuclear, cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 49
Gene Name: ANKRD49
Alternative Gene Name: FGIF, FLJ20189, GBIF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031931: 87%, ENSRNOG00000009233: 85%
Entrez Gene ID: 54851
Uniprot ID: Q8WVL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQ
Gene Sequence HLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQ
Gene ID - Mouse ENSMUSG00000031931
Gene ID - Rat ENSRNOG00000009233
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD49 pAb (ATL-HPA040273)
Datasheet Anti ANKRD49 pAb (ATL-HPA040273) Datasheet (External Link)
Vendor Page Anti ANKRD49 pAb (ATL-HPA040273) at Atlas Antibodies

Documents & Links for Anti ANKRD49 pAb (ATL-HPA040273)
Datasheet Anti ANKRD49 pAb (ATL-HPA040273) Datasheet (External Link)
Vendor Page Anti ANKRD49 pAb (ATL-HPA040273)