Anti ANKRD45 pAb (ATL-HPA031657 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA031657-25
  • Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-ANKRD45 antibody. Corresponding ANKRD45 RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ANKRD45 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY404885).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 45
Gene Name: ANKRD45
Alternative Gene Name: CT117, FLJ45235
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044835: 52%, ENSRNOG00000002890: 52%
Entrez Gene ID: 339416
Uniprot ID: Q5TZF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN
Gene Sequence KEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN
Gene ID - Mouse ENSMUSG00000044835
Gene ID - Rat ENSRNOG00000002890
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ANKRD45 pAb (ATL-HPA031657 w/enhanced validation)
Datasheet Anti ANKRD45 pAb (ATL-HPA031657 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANKRD45 pAb (ATL-HPA031657 w/enhanced validation)



Citations for Anti ANKRD45 pAb (ATL-HPA031657 w/enhanced validation) – 1 Found
Djureinovic, Dijana; Hallström, Björn M; Horie, Masafumi; Mattsson, Johanna Sofia Margareta; La Fleur, Linnea; Fagerberg, Linn; Brunnström, Hans; Lindskog, Cecilia; Madjar, Katrin; Rahnenführer, Jörg; Ekman, Simon; Ståhle, Elisabeth; Koyi, Hirsh; Brandén, Eva; Edlund, Karolina; Hengstler, Jan G; Lambe, Mats; Saito, Akira; Botling, Johan; Pontén, Fredrik; Uhlén, Mathias; Micke, Patrick. Profiling cancer testis antigens in non-small-cell lung cancer. Jci Insight. 2016;1(10):e86837.  PubMed