Anti ANKRD44 pAb (ATL-HPA030122)

Atlas Antibodies

Catalog No.:
ATL-HPA030122-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 44
Gene Name: ANKRD44
Alternative Gene Name: PP6-ARS-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052331: 93%, ENSRNOG00000021384: 91%
Entrez Gene ID: 91526
Uniprot ID: Q8N8A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
Gene Sequence TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
Gene ID - Mouse ENSMUSG00000052331
Gene ID - Rat ENSRNOG00000021384
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKRD44 pAb (ATL-HPA030122)
Datasheet Anti ANKRD44 pAb (ATL-HPA030122) Datasheet (External Link)
Vendor Page Anti ANKRD44 pAb (ATL-HPA030122) at Atlas Antibodies

Documents & Links for Anti ANKRD44 pAb (ATL-HPA030122)
Datasheet Anti ANKRD44 pAb (ATL-HPA030122) Datasheet (External Link)
Vendor Page Anti ANKRD44 pAb (ATL-HPA030122)