Anti ANKRD44 pAb (ATL-HPA030122)

Atlas Antibodies

Catalog No.: ATL-HPA030122-25

Protein Description: ankyrin repeat domain 44
Gene Name: ANKRD44
Alternative Gene Name: PP6-ARS-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052331: 93%, ENSRNOG00000021384: 91%
Entrez Gene ID: 91526
Uniprot ID: Q8N8A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
• Gene Sequence: TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR
• Gene ID - Mouse: ENSMUSG00000052331
• Gene ID - Rat: ENSRNOG00000021384
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.