Anti ANKRD42 pAb (ATL-HPA039917)

Atlas Antibodies

SKU:
ATL-HPA039917-25
  • Immunohistochemical staining of human fallopian tube shows distinct positivity in ciliated cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 42
Gene Name: ANKRD42
Alternative Gene Name: FLJ37874, PPP1R79, SARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041343: 79%, ENSRNOG00000009664: 83%
Entrez Gene ID: 338699
Uniprot ID: Q8N9B4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLI
Gene Sequence DNGENVLDLAQRFFKQNILQFIQGAEYEGKDLEDQETLAFPGHVAAFKGDLGMLKKLVEDGVININERADNGSTPMHKAAGQGHIECLQWLI
Gene ID - Mouse ENSMUSG00000041343
Gene ID - Rat ENSRNOG00000009664
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD42 pAb (ATL-HPA039917)
Datasheet Anti ANKRD42 pAb (ATL-HPA039917) Datasheet (External Link)
Vendor Page Anti ANKRD42 pAb (ATL-HPA039917) at Atlas Antibodies

Documents & Links for Anti ANKRD42 pAb (ATL-HPA039917)
Datasheet Anti ANKRD42 pAb (ATL-HPA039917) Datasheet (External Link)
Vendor Page Anti ANKRD42 pAb (ATL-HPA039917)