Anti ANKRD40 pAb (ATL-HPA021759 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021759-100
  • Immunohistochemical staining of human rectum shows strong nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & the Golgi apparatus.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ANKRD40 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY409432).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 40
Gene Name: ANKRD40
Alternative Gene Name: MGC15396
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020864: 78%, ENSRNOG00000002935: 80%
Entrez Gene ID: 91369
Uniprot ID: Q6AI12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IMGVEEEDDDDDDDDNLPQLKKESELPFVPNYLANPAFPFIYTPTAEDSAQMQNGGPSTPPASPPADGSPPLLP
Gene Sequence IMGVEEEDDDDDDDDNLPQLKKESELPFVPNYLANPAFPFIYTPTAEDSAQMQNGGPSTPPASPPADGSPPLLP
Gene ID - Mouse ENSMUSG00000020864
Gene ID - Rat ENSRNOG00000002935
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ANKRD40 pAb (ATL-HPA021759 w/enhanced validation)
Datasheet Anti ANKRD40 pAb (ATL-HPA021759 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANKRD40 pAb (ATL-HPA021759 w/enhanced validation)