Anti ANKRD39 pAb (ATL-HPA042678)

Atlas Antibodies

Catalog No.: ATL-HPA042678-25

Protein Description: ankyrin repeat domain 39
Gene Name: ANKRD39
Alternative Gene Name: MGC41816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079610: 95%, ENSRNOG00000023995: 91%
Entrez Gene ID: 51239
Uniprot ID: Q53RE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTE
• Gene Sequence: RVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTE
• Gene ID - Mouse: ENSMUSG00000079610
• Gene ID - Rat: ENSRNOG00000023995
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.