Anti ANKRD39 pAb (ATL-HPA042678)

Atlas Antibodies

SKU:
ATL-HPA042678-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 39
Gene Name: ANKRD39
Alternative Gene Name: MGC41816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079610: 95%, ENSRNOG00000023995: 91%
Entrez Gene ID: 51239
Uniprot ID: Q53RE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTE
Gene Sequence RVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLLESGAKCDAQTHGGATALHRASYCGHTE
Gene ID - Mouse ENSMUSG00000079610
Gene ID - Rat ENSRNOG00000023995
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD39 pAb (ATL-HPA042678)
Datasheet Anti ANKRD39 pAb (ATL-HPA042678) Datasheet (External Link)
Vendor Page Anti ANKRD39 pAb (ATL-HPA042678) at Atlas Antibodies

Documents & Links for Anti ANKRD39 pAb (ATL-HPA042678)
Datasheet Anti ANKRD39 pAb (ATL-HPA042678) Datasheet (External Link)
Vendor Page Anti ANKRD39 pAb (ATL-HPA042678)