Anti ANKRD37 pAb (ATL-HPA058127)

Atlas Antibodies

Catalog No.:
ATL-HPA058127-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 37
Gene Name: ANKRD37
Alternative Gene Name: Lrp2bp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050914: 91%, ENSRNOG00000031335: 94%
Entrez Gene ID: 353322
Uniprot ID: Q7Z713
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLV
Gene Sequence ASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLV
Gene ID - Mouse ENSMUSG00000050914
Gene ID - Rat ENSRNOG00000031335
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKRD37 pAb (ATL-HPA058127)
Datasheet Anti ANKRD37 pAb (ATL-HPA058127) Datasheet (External Link)
Vendor Page Anti ANKRD37 pAb (ATL-HPA058127) at Atlas Antibodies

Documents & Links for Anti ANKRD37 pAb (ATL-HPA058127)
Datasheet Anti ANKRD37 pAb (ATL-HPA058127) Datasheet (External Link)
Vendor Page Anti ANKRD37 pAb (ATL-HPA058127)