Anti ANKRD35 pAb (ATL-HPA035453 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035453-25

• 

Protein Description: ankyrin repeat domain 35
Gene Name: ANKRD35
Alternative Gene Name: FLJ25124
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038354: 78%, ENSRNOG00000025108: 78%
Entrez Gene ID: 148741
Uniprot ID: Q8N283
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLREELAAVWREKDAARGALSRPVMEGALGTPRAEAAAAAWEKMEARLERVLARLEWAKAGLQVKPEVPSQESREGALKAAPGSIKQDEEKEKRVPGA
• Gene Sequence: QLREELAAVWREKDAARGALSRPVMEGALGTPRAEAAAAAWEKMEARLERVLARLEWAKAGLQVKPEVPSQESREGALKAAPGSIKQDEEKEKRVPGA
• Gene ID - Mouse: ENSMUSG00000038354
• Gene ID - Rat: ENSRNOG00000025108
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ANKRD35 pAb (ATL-HPA035453 w/enhanced validation) – 1 Found

Wu, Chien-Ting; Lidsky, Peter V; Xiao, Yinghong; Cheng, Ran; Lee, Ivan T; Nakayama, Tsuguhisa; Jiang, Sizun; He, Wei; Demeter, Janos; Knight, Miguel G; Turn, Rachel E; Rojas-Hernandez, Laura S; Ye, Chengjin; Chiem, Kevin; Shon, Judy; Martinez-Sobrido, Luis; Bertozzi, Carolyn R; Nolan, Garry P; Nayak, Jayakar V; Milla, Carlos; Andino, Raul; Jackson, Peter K. SARS-CoV-2 replication in airway epithelia requires motile cilia and microvillar reprogramming. Cell. 2023;186(1):112-130.e20.