Anti ANKRD34C pAb (ATL-HPA045329)

Atlas Antibodies

Catalog No.:
ATL-HPA045329-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 34C
Gene Name: ANKRD34C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047606: 86%, ENSRNOG00000013937: 85%
Entrez Gene ID: 390616
Uniprot ID: P0C6C1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIAPSVLAASTRQDETHGASTDNEVIKSISDISFPKRGPLSRTNSIDSKDPTLFHTVTEQVLKIPVSSAPASWKAAYEKGQAPHPRLARRGTL
Gene Sequence LIAPSVLAASTRQDETHGASTDNEVIKSISDISFPKRGPLSRTNSIDSKDPTLFHTVTEQVLKIPVSSAPASWKAAYEKGQAPHPRLARRGTL
Gene ID - Mouse ENSMUSG00000047606
Gene ID - Rat ENSRNOG00000013937
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKRD34C pAb (ATL-HPA045329)
Datasheet Anti ANKRD34C pAb (ATL-HPA045329) Datasheet (External Link)
Vendor Page Anti ANKRD34C pAb (ATL-HPA045329) at Atlas Antibodies

Documents & Links for Anti ANKRD34C pAb (ATL-HPA045329)
Datasheet Anti ANKRD34C pAb (ATL-HPA045329) Datasheet (External Link)
Vendor Page Anti ANKRD34C pAb (ATL-HPA045329)