Anti ANKRD34B pAb (ATL-HPA043327)

Atlas Antibodies

Catalog No.: ATL-HPA043327-25

Protein Description: ankyrin repeat domain 34B
Gene Name: ANKRD34B
Alternative Gene Name: DP58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045034: 78%, ENSRNOG00000040166: 78%
Entrez Gene ID: 340120
Uniprot ID: A5PLL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLSRRNHAVLERRGSGAFPLDHSVTQTR
• Gene Sequence: HYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLSRRNHAVLERRGSGAFPLDHSVTQTR
• Gene ID - Mouse: ENSMUSG00000045034
• Gene ID - Rat: ENSRNOG00000040166
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.