Anti ANKRD34B pAb (ATL-HPA043327)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043327-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ANKRD34B
Alternative Gene Name: DP58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045034: 78%, ENSRNOG00000040166: 78%
Entrez Gene ID: 340120
Uniprot ID: A5PLL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLSRRNHAVLERRGSGAFPLDHSVTQTR |
| Gene Sequence | HYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLSRRNHAVLERRGSGAFPLDHSVTQTR |
| Gene ID - Mouse | ENSMUSG00000045034 |
| Gene ID - Rat | ENSRNOG00000040166 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKRD34B pAb (ATL-HPA043327) | |
| Datasheet | Anti ANKRD34B pAb (ATL-HPA043327) Datasheet (External Link) |
| Vendor Page | Anti ANKRD34B pAb (ATL-HPA043327) at Atlas Antibodies |
| Documents & Links for Anti ANKRD34B pAb (ATL-HPA043327) | |
| Datasheet | Anti ANKRD34B pAb (ATL-HPA043327) Datasheet (External Link) |
| Vendor Page | Anti ANKRD34B pAb (ATL-HPA043327) |