Anti ANKRD34B pAb (ATL-HPA043327)

Atlas Antibodies

SKU:
ATL-HPA043327-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 34B
Gene Name: ANKRD34B
Alternative Gene Name: DP58
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045034: 78%, ENSRNOG00000040166: 78%
Entrez Gene ID: 340120
Uniprot ID: A5PLL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLSRRNHAVLERRGSGAFPLDHSVTQTR
Gene Sequence HYSSDSQLSAGLTPPTSEDGKALIGKKKILSPSPSQLSESKELLENIPPGPLSRRNHAVLERRGSGAFPLDHSVTQTR
Gene ID - Mouse ENSMUSG00000045034
Gene ID - Rat ENSRNOG00000040166
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD34B pAb (ATL-HPA043327)
Datasheet Anti ANKRD34B pAb (ATL-HPA043327) Datasheet (External Link)
Vendor Page Anti ANKRD34B pAb (ATL-HPA043327) at Atlas Antibodies

Documents & Links for Anti ANKRD34B pAb (ATL-HPA043327)
Datasheet Anti ANKRD34B pAb (ATL-HPA043327) Datasheet (External Link)
Vendor Page Anti ANKRD34B pAb (ATL-HPA043327)