Anti ANKRD34A pAb (ATL-HPA029643)

Atlas Antibodies

Catalog No.:
ATL-HPA029643-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 34A
Gene Name: ANKRD34A
Alternative Gene Name: ANKRD34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049097: 93%, ENSRNOG00000033741: 93%
Entrez Gene ID: 284615
Uniprot ID: Q69YU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGTKKTRQYLNSPPSPGVEDPAPASPSPGFCTSPSEIQLQTAGGGGRGMLSPRAQEEEEKRDVFEFPLPKPPDDPSPSEPLPKPP
Gene Sequence SGTKKTRQYLNSPPSPGVEDPAPASPSPGFCTSPSEIQLQTAGGGGRGMLSPRAQEEEEKRDVFEFPLPKPPDDPSPSEPLPKPP
Gene ID - Mouse ENSMUSG00000049097
Gene ID - Rat ENSRNOG00000033741
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKRD34A pAb (ATL-HPA029643)
Datasheet Anti ANKRD34A pAb (ATL-HPA029643) Datasheet (External Link)
Vendor Page Anti ANKRD34A pAb (ATL-HPA029643) at Atlas Antibodies

Documents & Links for Anti ANKRD34A pAb (ATL-HPA029643)
Datasheet Anti ANKRD34A pAb (ATL-HPA029643) Datasheet (External Link)
Vendor Page Anti ANKRD34A pAb (ATL-HPA029643)