Anti ANKRD33 pAb (ATL-HPA058753)

Atlas Antibodies

SKU:
ATL-HPA058753-25
  • Immunohistochemical staining of human kidney shows strong luminal membranous positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 33
Gene Name: ANKRD33
Alternative Gene Name: C12orf7, DKFZp686O1689, PANKY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041044: 24%, ENSRNOG00000049733: 23%
Entrez Gene ID: 341405
Uniprot ID: Q7Z3H0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASWGGIVHLEAFGDPVIVLRGAWAVPRVDCLIDTLRTPNASCMRKGTHLLVPCLEEEELALHRRRLDMSEALPCPGKETPTPGCRLGALYWACVHNDPTQL
Gene Sequence ASWGGIVHLEAFGDPVIVLRGAWAVPRVDCLIDTLRTPNASCMRKGTHLLVPCLEEEELALHRRRLDMSEALPCPGKETPTPGCRLGALYWACVHNDPTQL
Gene ID - Mouse ENSMUSG00000041044
Gene ID - Rat ENSRNOG00000049733
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD33 pAb (ATL-HPA058753)
Datasheet Anti ANKRD33 pAb (ATL-HPA058753) Datasheet (External Link)
Vendor Page Anti ANKRD33 pAb (ATL-HPA058753) at Atlas Antibodies

Documents & Links for Anti ANKRD33 pAb (ATL-HPA058753)
Datasheet Anti ANKRD33 pAb (ATL-HPA058753) Datasheet (External Link)
Vendor Page Anti ANKRD33 pAb (ATL-HPA058753)