Anti ANKRD30B pAb (ATL-HPA060455)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060455-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ANKRD30B
Alternative Gene Name: NY-BR-1.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064293: 26%, ENSRNOG00000005652: 26%
Entrez Gene ID: 374860
Uniprot ID: Q9BXX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KASTNVDVSSVEPIFSLFGTRTIENSQCTKVEEDFNLATKIISKSAAQNYTCLPDATYQKDIKTINHKIEDQMFPS |
| Gene Sequence | KASTNVDVSSVEPIFSLFGTRTIENSQCTKVEEDFNLATKIISKSAAQNYTCLPDATYQKDIKTINHKIEDQMFPS |
| Gene ID - Mouse | ENSMUSG00000064293 |
| Gene ID - Rat | ENSRNOG00000005652 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKRD30B pAb (ATL-HPA060455) | |
| Datasheet | Anti ANKRD30B pAb (ATL-HPA060455) Datasheet (External Link) |
| Vendor Page | Anti ANKRD30B pAb (ATL-HPA060455) at Atlas Antibodies |
| Documents & Links for Anti ANKRD30B pAb (ATL-HPA060455) | |
| Datasheet | Anti ANKRD30B pAb (ATL-HPA060455) Datasheet (External Link) |
| Vendor Page | Anti ANKRD30B pAb (ATL-HPA060455) |