Anti ANKRD30B pAb (ATL-HPA060455)

Atlas Antibodies

Catalog No.:
ATL-HPA060455-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 30B
Gene Name: ANKRD30B
Alternative Gene Name: NY-BR-1.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064293: 26%, ENSRNOG00000005652: 26%
Entrez Gene ID: 374860
Uniprot ID: Q9BXX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KASTNVDVSSVEPIFSLFGTRTIENSQCTKVEEDFNLATKIISKSAAQNYTCLPDATYQKDIKTINHKIEDQMFPS
Gene Sequence KASTNVDVSSVEPIFSLFGTRTIENSQCTKVEEDFNLATKIISKSAAQNYTCLPDATYQKDIKTINHKIEDQMFPS
Gene ID - Mouse ENSMUSG00000064293
Gene ID - Rat ENSRNOG00000005652
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKRD30B pAb (ATL-HPA060455)
Datasheet Anti ANKRD30B pAb (ATL-HPA060455) Datasheet (External Link)
Vendor Page Anti ANKRD30B pAb (ATL-HPA060455) at Atlas Antibodies

Documents & Links for Anti ANKRD30B pAb (ATL-HPA060455)
Datasheet Anti ANKRD30B pAb (ATL-HPA060455) Datasheet (External Link)
Vendor Page Anti ANKRD30B pAb (ATL-HPA060455)