Anti ANKRD29 pAb (ATL-HPA041272 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041272-100
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ANKRD29 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406585).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 29
Gene Name: ANKRD29
Alternative Gene Name: FLJ25053
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057766: 97%, ENSRNOG00000011856: 96%
Entrez Gene ID: 147463
Uniprot ID: Q8N6D5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QKETPLANAAFWAARRGNLALLKLLLNSGRVDVDCRDSHGTTLLMVAAYAGHIDCVRELVLQGADINLQRESGTTALFFAAQQGHNDVVRFLF
Gene Sequence QKETPLANAAFWAARRGNLALLKLLLNSGRVDVDCRDSHGTTLLMVAAYAGHIDCVRELVLQGADINLQRESGTTALFFAAQQGHNDVVRFLF
Gene ID - Mouse ENSMUSG00000057766
Gene ID - Rat ENSRNOG00000011856
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ANKRD29 pAb (ATL-HPA041272 w/enhanced validation)
Datasheet Anti ANKRD29 pAb (ATL-HPA041272 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANKRD29 pAb (ATL-HPA041272 w/enhanced validation)