Anti ANKRD27 pAb (ATL-HPA042769)

Atlas Antibodies

SKU:
ATL-HPA042769-25
  • Immunohistochemical staining of human thyroid gland shows cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 27 (VPS9 domain)
Gene Name: ANKRD27
Alternative Gene Name: DKFZp434L0718, FLJ00040, VARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034867: 87%, ENSRNOG00000052814: 85%
Entrez Gene ID: 84079
Uniprot ID: Q96NW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MALYDEDLLKNPFYLALQKCRPDLCSKVAQIHGIVLVPCKGSLSSSIQSTCQFESYILIPVEEHFQTLNGKDVFIQGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCI
Gene Sequence MALYDEDLLKNPFYLALQKCRPDLCSKVAQIHGIVLVPCKGSLSSSIQSTCQFESYILIPVEEHFQTLNGKDVFIQGNRIKLGAGFACLLSVPILFEETFYNEKEESFSILCI
Gene ID - Mouse ENSMUSG00000034867
Gene ID - Rat ENSRNOG00000052814
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD27 pAb (ATL-HPA042769)
Datasheet Anti ANKRD27 pAb (ATL-HPA042769) Datasheet (External Link)
Vendor Page Anti ANKRD27 pAb (ATL-HPA042769) at Atlas Antibodies

Documents & Links for Anti ANKRD27 pAb (ATL-HPA042769)
Datasheet Anti ANKRD27 pAb (ATL-HPA042769) Datasheet (External Link)
Vendor Page Anti ANKRD27 pAb (ATL-HPA042769)