Anti ANKRD26 pAb (ATL-HPA040654)

Atlas Antibodies

SKU: ATL-HPA040654-25

• 
• 

Protein Description: ankyrin repeat domain 26
Gene Name: ANKRD26
Alternative Gene Name: KIAA1074, THC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007827: 50%, ENSRNOG00000006717: 56%
Entrez Gene ID: 22852
Uniprot ID: Q9UPS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DNAKLKVTVKKQMDKIEELQKNLLNANLSEDEKEQLKKLMELKQSLECNLDQEMKKNVELEREITGFKNL
• Gene Sequence: DNAKLKVTVKKQMDKIEELQKNLLNANLSEDEKEQLKKLMELKQSLECNLDQEMKKNVELEREITGFKNL
• Gene ID - Mouse: ENSMUSG00000007827
• Gene ID - Rat: ENSRNOG00000006717
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.