Anti ANKRD20A4 pAb (ATL-HPA051753)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051753-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ANKRD20A4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007827: 37%, ENSRNOG00000006717: 34%
Entrez Gene ID: 728747
Uniprot ID: Q4UJ75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALERTQDVSVQVEMSSAISKVKDENEFLTEQLS |
Gene Sequence | ALERTQDVSVQVEMSSAISKVKDENEFLTEQLS |
Gene ID - Mouse | ENSMUSG00000007827 |
Gene ID - Rat | ENSRNOG00000006717 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANKRD20A4 pAb (ATL-HPA051753) | |
Datasheet | Anti ANKRD20A4 pAb (ATL-HPA051753) Datasheet (External Link) |
Vendor Page | Anti ANKRD20A4 pAb (ATL-HPA051753) at Atlas Antibodies |
Documents & Links for Anti ANKRD20A4 pAb (ATL-HPA051753) | |
Datasheet | Anti ANKRD20A4 pAb (ATL-HPA051753) Datasheet (External Link) |
Vendor Page | Anti ANKRD20A4 pAb (ATL-HPA051753) |