Anti ANKRD20A4 pAb (ATL-HPA051753)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051753-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ANKRD20A4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007827: 37%, ENSRNOG00000006717: 34%
Entrez Gene ID: 728747
Uniprot ID: Q4UJ75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALERTQDVSVQVEMSSAISKVKDENEFLTEQLS |
| Gene Sequence | ALERTQDVSVQVEMSSAISKVKDENEFLTEQLS |
| Gene ID - Mouse | ENSMUSG00000007827 |
| Gene ID - Rat | ENSRNOG00000006717 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKRD20A4 pAb (ATL-HPA051753) | |
| Datasheet | Anti ANKRD20A4 pAb (ATL-HPA051753) Datasheet (External Link) |
| Vendor Page | Anti ANKRD20A4 pAb (ATL-HPA051753) at Atlas Antibodies |
| Documents & Links for Anti ANKRD20A4 pAb (ATL-HPA051753) | |
| Datasheet | Anti ANKRD20A4 pAb (ATL-HPA051753) Datasheet (External Link) |
| Vendor Page | Anti ANKRD20A4 pAb (ATL-HPA051753) |