Anti ANKRD20A4 pAb (ATL-HPA051753)

Atlas Antibodies

SKU: ATL-HPA051753-25

• 

Protein Description: ankyrin repeat domain 20 family, member A4
Gene Name: ANKRD20A4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007827: 37%, ENSRNOG00000006717: 34%
Entrez Gene ID: 728747
Uniprot ID: Q4UJ75
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALERTQDVSVQVEMSSAISKVKDENEFLTEQLS
• Gene Sequence: ALERTQDVSVQVEMSSAISKVKDENEFLTEQLS
• Gene ID - Mouse: ENSMUSG00000007827
• Gene ID - Rat: ENSRNOG00000006717
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.