Anti ANKRD18A pAb (ATL-HPA049923)

Atlas Antibodies

Catalog No.: ATL-HPA049923-25

Protein Description: ankyrin repeat domain 18A
Gene Name: ANKRD18A
Alternative Gene Name: FLJ35740, KIAA2015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047696: 39%, ENSRNOG00000020804: 42%
Entrez Gene ID: 253650
Uniprot ID: Q8IVF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KELTLKDVECKFSEMKTAYEEVTTELEEYKEAFAAA
• Gene Sequence: KELTLKDVECKFSEMKTAYEEVTTELEEYKEAFAAA
• Gene ID - Mouse: ENSMUSG00000047696
• Gene ID - Rat: ENSRNOG00000020804
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.