Anti ANKRD18A pAb (ATL-HPA049923)

Atlas Antibodies

Catalog No.:
ATL-HPA049923-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 18A
Gene Name: ANKRD18A
Alternative Gene Name: FLJ35740, KIAA2015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047696: 39%, ENSRNOG00000020804: 42%
Entrez Gene ID: 253650
Uniprot ID: Q8IVF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KELTLKDVECKFSEMKTAYEEVTTELEEYKEAFAAA
Gene Sequence KELTLKDVECKFSEMKTAYEEVTTELEEYKEAFAAA
Gene ID - Mouse ENSMUSG00000047696
Gene ID - Rat ENSRNOG00000020804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKRD18A pAb (ATL-HPA049923)
Datasheet Anti ANKRD18A pAb (ATL-HPA049923) Datasheet (External Link)
Vendor Page Anti ANKRD18A pAb (ATL-HPA049923) at Atlas Antibodies

Documents & Links for Anti ANKRD18A pAb (ATL-HPA049923)
Datasheet Anti ANKRD18A pAb (ATL-HPA049923) Datasheet (External Link)
Vendor Page Anti ANKRD18A pAb (ATL-HPA049923)