Anti ANKRD18A pAb (ATL-HPA049923)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049923-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ANKRD18A
Alternative Gene Name: FLJ35740, KIAA2015
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047696: 39%, ENSRNOG00000020804: 42%
Entrez Gene ID: 253650
Uniprot ID: Q8IVF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KELTLKDVECKFSEMKTAYEEVTTELEEYKEAFAAA |
| Gene Sequence | KELTLKDVECKFSEMKTAYEEVTTELEEYKEAFAAA |
| Gene ID - Mouse | ENSMUSG00000047696 |
| Gene ID - Rat | ENSRNOG00000020804 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKRD18A pAb (ATL-HPA049923) | |
| Datasheet | Anti ANKRD18A pAb (ATL-HPA049923) Datasheet (External Link) |
| Vendor Page | Anti ANKRD18A pAb (ATL-HPA049923) at Atlas Antibodies |
| Documents & Links for Anti ANKRD18A pAb (ATL-HPA049923) | |
| Datasheet | Anti ANKRD18A pAb (ATL-HPA049923) Datasheet (External Link) |
| Vendor Page | Anti ANKRD18A pAb (ATL-HPA049923) |