Anti ANKRD16 pAb (ATL-HPA037920)

Atlas Antibodies

SKU:
ATL-HPA037920-25
  • Immunohistochemical staining of human cerebellum shows positivity in purkinje cells and neuronal processes.
  • Immunofluorescent staining of human cell line A549 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 16
Gene Name: ANKRD16
Alternative Gene Name: DKFZP434N1511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047909: 90%, ENSRNOG00000028168: 89%
Entrez Gene ID: 54522
Uniprot ID: Q6P6B7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLL
Gene Sequence WTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLL
Gene ID - Mouse ENSMUSG00000047909
Gene ID - Rat ENSRNOG00000028168
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD16 pAb (ATL-HPA037920)
Datasheet Anti ANKRD16 pAb (ATL-HPA037920) Datasheet (External Link)
Vendor Page Anti ANKRD16 pAb (ATL-HPA037920) at Atlas Antibodies

Documents & Links for Anti ANKRD16 pAb (ATL-HPA037920)
Datasheet Anti ANKRD16 pAb (ATL-HPA037920) Datasheet (External Link)
Vendor Page Anti ANKRD16 pAb (ATL-HPA037920)