Anti ANKRD13D pAb (ATL-HPA039950)

Atlas Antibodies

Catalog No.: ATL-HPA039950-25

Protein Description: ankyrin repeat domain 13 family, member D
Gene Name: ANKRD13D
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005986: 84%, ENSRNOG00000028247: 86%
Entrez Gene ID: 338692
Uniprot ID: Q6ZTN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITFSNLCGCDEPLSSVWVPAPSSAVAASGNPFPCEVDPTVFEVPNGYSVLGMERNEPLRDEDD
• Gene Sequence: ITFSNLCGCDEPLSSVWVPAPSSAVAASGNPFPCEVDPTVFEVPNGYSVLGMERNEPLRDEDD
• Gene ID - Mouse: ENSMUSG00000005986
• Gene ID - Rat: ENSRNOG00000028247
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.