Anti ANKRD13A pAb (ATL-HPA043218 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA043218-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-ANKRD13A antibody. Corresponding ANKRD13A RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 13A
Gene Name: ANKRD13A
Alternative Gene Name: ANKRD13, NY-REN-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041870: 82%, ENSRNOG00000001204: 79%
Entrez Gene ID: 88455
Uniprot ID: Q8IZ07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEE
Gene Sequence IQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEE
Gene ID - Mouse ENSMUSG00000041870
Gene ID - Rat ENSRNOG00000001204
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ANKRD13A pAb (ATL-HPA043218 w/enhanced validation)
Datasheet Anti ANKRD13A pAb (ATL-HPA043218 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ANKRD13A pAb (ATL-HPA043218 w/enhanced validation)