Anti ANKRD13A pAb (ATL-HPA043218 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043218-25

Protein Description: ankyrin repeat domain 13A
Gene Name: ANKRD13A
Alternative Gene Name: ANKRD13, NY-REN-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041870: 82%, ENSRNOG00000001204: 79%
Entrez Gene ID: 88455
Uniprot ID: Q8IZ07
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEE
• Gene Sequence: IQQSLLESSRSQELSGPASNGGISQTNTYDAQYERAIQESLLTSTEGLCPSALSETSRFDNDLQLAMELSAKELEEWELRLQEE
• Gene ID - Mouse: ENSMUSG00000041870
• Gene ID - Rat: ENSRNOG00000001204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.