Anti ANKRD11 pAb (ATL-HPA041593)

Atlas Antibodies

SKU:
ATL-HPA041593-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 11
Gene Name: ANKRD11
Alternative Gene Name: LZ16, T13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035569: 84%, ENSRNOG00000027906: 84%
Entrez Gene ID: 29123
Uniprot ID: Q6UB99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSCPSYEEVMHTPRTPSCSADDYADLVFDCADSQHSTPVPTAPTSACSPSFFDRFSVASSGLSENASQAPARPLSTNLYRSVSVDIRRTPEEEFSVG
Gene Sequence LSCPSYEEVMHTPRTPSCSADDYADLVFDCADSQHSTPVPTAPTSACSPSFFDRFSVASSGLSENASQAPARPLSTNLYRSVSVDIRRTPEEEFSVG
Gene ID - Mouse ENSMUSG00000035569
Gene ID - Rat ENSRNOG00000027906
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD11 pAb (ATL-HPA041593)
Datasheet Anti ANKRD11 pAb (ATL-HPA041593) Datasheet (External Link)
Vendor Page Anti ANKRD11 pAb (ATL-HPA041593) at Atlas Antibodies

Documents & Links for Anti ANKRD11 pAb (ATL-HPA041593)
Datasheet Anti ANKRD11 pAb (ATL-HPA041593) Datasheet (External Link)
Vendor Page Anti ANKRD11 pAb (ATL-HPA041593)