Anti ANKRD10 pAb (ATL-HPA038879)

Atlas Antibodies

SKU:
ATL-HPA038879-25
  • Immunohistochemical staining of human stomach shows cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & microtubules.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat domain 10
Gene Name: ANKRD10
Alternative Gene Name: FLJ20093
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031508: 78%, ENSRNOG00000013618: 81%
Entrez Gene ID: 55608
Uniprot ID: Q9NXR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DCEGETPIHKAARSGSLECISALVANGAHVDLRNASGLTAADIAQTQGFQECAQFLLNLQNCHLNHFYNNGILNGGHQNVFPNHISVGTNRKRCLEDSE
Gene Sequence DCEGETPIHKAARSGSLECISALVANGAHVDLRNASGLTAADIAQTQGFQECAQFLLNLQNCHLNHFYNNGILNGGHQNVFPNHISVGTNRKRCLEDSE
Gene ID - Mouse ENSMUSG00000031508
Gene ID - Rat ENSRNOG00000013618
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKRD10 pAb (ATL-HPA038879)
Datasheet Anti ANKRD10 pAb (ATL-HPA038879) Datasheet (External Link)
Vendor Page Anti ANKRD10 pAb (ATL-HPA038879) at Atlas Antibodies

Documents & Links for Anti ANKRD10 pAb (ATL-HPA038879)
Datasheet Anti ANKRD10 pAb (ATL-HPA038879) Datasheet (External Link)
Vendor Page Anti ANKRD10 pAb (ATL-HPA038879)