Anti ANKRA2 pAb (ATL-HPA065263)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065263-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ANKRA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021661: 85%, ENSRNOG00000048118: 87%
Entrez Gene ID: 57763
Uniprot ID: Q9H9E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKS |
Gene Sequence | MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKS |
Gene ID - Mouse | ENSMUSG00000021661 |
Gene ID - Rat | ENSRNOG00000048118 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANKRA2 pAb (ATL-HPA065263) | |
Datasheet | Anti ANKRA2 pAb (ATL-HPA065263) Datasheet (External Link) |
Vendor Page | Anti ANKRA2 pAb (ATL-HPA065263) at Atlas Antibodies |
Documents & Links for Anti ANKRA2 pAb (ATL-HPA065263) | |
Datasheet | Anti ANKRA2 pAb (ATL-HPA065263) Datasheet (External Link) |
Vendor Page | Anti ANKRA2 pAb (ATL-HPA065263) |