Anti ANKRA2 pAb (ATL-HPA065263)

Atlas Antibodies

Catalog No.:
ATL-HPA065263-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat, family A (RFXANK-like), 2
Gene Name: ANKRA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021661: 85%, ENSRNOG00000048118: 87%
Entrez Gene ID: 57763
Uniprot ID: Q9H9E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKS
Gene Sequence MDTSTNLDIGAQLIVEECPSTYSLTGMPDIKIEHPLDPNSEEGSAQGVAMGMKFILPNRFDMNVCSRFVKS
Gene ID - Mouse ENSMUSG00000021661
Gene ID - Rat ENSRNOG00000048118
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKRA2 pAb (ATL-HPA065263)
Datasheet Anti ANKRA2 pAb (ATL-HPA065263) Datasheet (External Link)
Vendor Page Anti ANKRA2 pAb (ATL-HPA065263) at Atlas Antibodies

Documents & Links for Anti ANKRA2 pAb (ATL-HPA065263)
Datasheet Anti ANKRA2 pAb (ATL-HPA065263) Datasheet (External Link)
Vendor Page Anti ANKRA2 pAb (ATL-HPA065263)