Anti ANKMY1 pAb (ATL-HPA026620)

Atlas Antibodies

Catalog No.:
ATL-HPA026620-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and MYND domain containing 1
Gene Name: ANKMY1
Alternative Gene Name: FLJ20499, ZMYND13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078676: 20%, ENSRNOG00000013369: 26%
Entrez Gene ID: 51281
Uniprot ID: Q9P2S6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSFMDTNLESLYYEVNVPSQGSYELRPPPAPLLLPRVSGSHEGGHFQDTGQCGGSIDHRSSSLKGDSPLVKGSLGHVESGLEDVLGNTDRGSLCSAETKFESNVCVCDFSIELSQAMLERSAQSHSLLKMA
Gene Sequence SSFMDTNLESLYYEVNVPSQGSYELRPPPAPLLLPRVSGSHEGGHFQDTGQCGGSIDHRSSSLKGDSPLVKGSLGHVESGLEDVLGNTDRGSLCSAETKFESNVCVCDFSIELSQAMLERSAQSHSLLKMA
Gene ID - Mouse ENSMUSG00000078676
Gene ID - Rat ENSRNOG00000013369
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKMY1 pAb (ATL-HPA026620)
Datasheet Anti ANKMY1 pAb (ATL-HPA026620) Datasheet (External Link)
Vendor Page Anti ANKMY1 pAb (ATL-HPA026620) at Atlas Antibodies

Documents & Links for Anti ANKMY1 pAb (ATL-HPA026620)
Datasheet Anti ANKMY1 pAb (ATL-HPA026620) Datasheet (External Link)
Vendor Page Anti ANKMY1 pAb (ATL-HPA026620)
Citations for Anti ANKMY1 pAb (ATL-HPA026620) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed