Anti ANKLE2 pAb (ATL-HPA003602)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003602-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ANKLE2
Alternative Gene Name: KIAA0692, Lem4, LEMD7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029501: 91%, ENSRNOG00000060144: 90%
Entrez Gene ID: 23141
Uniprot ID: Q86XL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH |
Gene Sequence | SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH |
Gene ID - Mouse | ENSMUSG00000029501 |
Gene ID - Rat | ENSRNOG00000060144 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANKLE2 pAb (ATL-HPA003602) | |
Datasheet | Anti ANKLE2 pAb (ATL-HPA003602) Datasheet (External Link) |
Vendor Page | Anti ANKLE2 pAb (ATL-HPA003602) at Atlas Antibodies |
Documents & Links for Anti ANKLE2 pAb (ATL-HPA003602) | |
Datasheet | Anti ANKLE2 pAb (ATL-HPA003602) Datasheet (External Link) |
Vendor Page | Anti ANKLE2 pAb (ATL-HPA003602) |
Citations for Anti ANKLE2 pAb (ATL-HPA003602) – 1 Found |
Kaufmann, Tanja; Kukolj, Eva; Brachner, Andreas; Beltzung, Etienne; Bruno, Melania; Kostrhon, Sebastian; Opravil, Susanne; Hudecz, Otto; Mechtler, Karl; Warren, Graham; Slade, Dea. SIRT2 regulates nuclear envelope reassembly through ANKLE2 deacetylation. Journal Of Cell Science. 2016;129(24):4607-4621. PubMed |