Anti ANKLE2 pAb (ATL-HPA003602)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA003602-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $303.00
    
         
                            Gene Name: ANKLE2
Alternative Gene Name: KIAA0692, Lem4, LEMD7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029501: 91%, ENSRNOG00000060144: 90%
Entrez Gene ID: 23141
Uniprot ID: Q86XL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH | 
| Gene Sequence | SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH | 
| Gene ID - Mouse | ENSMUSG00000029501 | 
| Gene ID - Rat | ENSRNOG00000060144 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti ANKLE2 pAb (ATL-HPA003602) | |
| Datasheet | Anti ANKLE2 pAb (ATL-HPA003602) Datasheet (External Link) | 
| Vendor Page | Anti ANKLE2 pAb (ATL-HPA003602) at Atlas Antibodies | 
| Documents & Links for Anti ANKLE2 pAb (ATL-HPA003602) | |
| Datasheet | Anti ANKLE2 pAb (ATL-HPA003602) Datasheet (External Link) | 
| Vendor Page | Anti ANKLE2 pAb (ATL-HPA003602) | 
| Citations for Anti ANKLE2 pAb (ATL-HPA003602) – 1 Found | 
| Kaufmann, Tanja; Kukolj, Eva; Brachner, Andreas; Beltzung, Etienne; Bruno, Melania; Kostrhon, Sebastian; Opravil, Susanne; Hudecz, Otto; Mechtler, Karl; Warren, Graham; Slade, Dea. SIRT2 regulates nuclear envelope reassembly through ANKLE2 deacetylation. Journal Of Cell Science. 2016;129(24):4607-4621. PubMed |