Anti ANKLE2 pAb (ATL-HPA003602)

Atlas Antibodies

SKU:
ATL-HPA003602-25
  • Western blot analysis in human cell line U-138MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and LEM domain containing 2
Gene Name: ANKLE2
Alternative Gene Name: KIAA0692, Lem4, LEMD7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029501: 91%, ENSRNOG00000060144: 90%
Entrez Gene ID: 23141
Uniprot ID: Q86XL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH
Gene Sequence SETVNKERANSYKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAKENQASICQLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADVVNVLSSH
Gene ID - Mouse ENSMUSG00000029501
Gene ID - Rat ENSRNOG00000060144
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKLE2 pAb (ATL-HPA003602)
Datasheet Anti ANKLE2 pAb (ATL-HPA003602) Datasheet (External Link)
Vendor Page Anti ANKLE2 pAb (ATL-HPA003602) at Atlas Antibodies

Documents & Links for Anti ANKLE2 pAb (ATL-HPA003602)
Datasheet Anti ANKLE2 pAb (ATL-HPA003602) Datasheet (External Link)
Vendor Page Anti ANKLE2 pAb (ATL-HPA003602)



Citations for Anti ANKLE2 pAb (ATL-HPA003602) – 1 Found
Kaufmann, Tanja; Kukolj, Eva; Brachner, Andreas; Beltzung, Etienne; Bruno, Melania; Kostrhon, Sebastian; Opravil, Susanne; Hudecz, Otto; Mechtler, Karl; Warren, Graham; Slade, Dea. SIRT2 regulates nuclear envelope reassembly through ANKLE2 deacetylation. Journal Of Cell Science. 2016;129(24):4607-4621.  PubMed