Anti ANKLE1 pAb (ATL-HPA073498)

Atlas Antibodies

Catalog No.:
ATL-HPA073498-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and LEM domain containing 1
Gene Name: ANKLE1
Alternative Gene Name: ANKRD41, FLJ39369, LEMD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046295: 57%, ENSRNOG00000017156: 59%
Entrez Gene ID: 126549
Uniprot ID: Q8NAG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STVSDLELLKGLRALGENPHPITPFTRQLYHQQLEEAQIAPGPEFSGHSLELAAALRTGCIPDVQADEDALAQQFEQPDP
Gene Sequence STVSDLELLKGLRALGENPHPITPFTRQLYHQQLEEAQIAPGPEFSGHSLELAAALRTGCIPDVQADEDALAQQFEQPDP
Gene ID - Mouse ENSMUSG00000046295
Gene ID - Rat ENSRNOG00000017156
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKLE1 pAb (ATL-HPA073498)
Datasheet Anti ANKLE1 pAb (ATL-HPA073498) Datasheet (External Link)
Vendor Page Anti ANKLE1 pAb (ATL-HPA073498) at Atlas Antibodies

Documents & Links for Anti ANKLE1 pAb (ATL-HPA073498)
Datasheet Anti ANKLE1 pAb (ATL-HPA073498) Datasheet (External Link)
Vendor Page Anti ANKLE1 pAb (ATL-HPA073498)
Citations for Anti ANKLE1 pAb (ATL-HPA073498) – 1 Found
Bakshi, Divya; Katoch, Archana; Chakraborty, Souneek; Shah, Ruchi; Sharma, Bhanu; Bhat, Amrita; Verma, Sonali; Bhat, Gh Rasool; Nagpal, Ashna; Vaishnavi, Samantha; Goswami, Anindya; Kumar, Rakesh. ANKLE1 as New Hotspot Mutation for Breast Cancer in Indian Population and Has a Role in DNA Damage and Repair in Mammalian Cells. Frontiers In Genetics. 11( 33584808):609758.  PubMed