Anti ANKK1 pAb (ATL-HPA012813)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012813-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ANKK1
Alternative Gene Name: X-kinase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032257: 74%, ENSRNOG00000025037: 77%
Entrez Gene ID: 255239
Uniprot ID: Q8NFD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER |
Gene Sequence | EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER |
Gene ID - Mouse | ENSMUSG00000032257 |
Gene ID - Rat | ENSRNOG00000025037 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANKK1 pAb (ATL-HPA012813) | |
Datasheet | Anti ANKK1 pAb (ATL-HPA012813) Datasheet (External Link) |
Vendor Page | Anti ANKK1 pAb (ATL-HPA012813) at Atlas Antibodies |
Documents & Links for Anti ANKK1 pAb (ATL-HPA012813) | |
Datasheet | Anti ANKK1 pAb (ATL-HPA012813) Datasheet (External Link) |
Vendor Page | Anti ANKK1 pAb (ATL-HPA012813) |