Anti ANKK1 pAb (ATL-HPA012813)

Atlas Antibodies

SKU: ATL-HPA012813-25

• 

Protein Description: ankyrin repeat and kinase domain containing 1
Gene Name: ANKK1
Alternative Gene Name: X-kinase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032257: 74%, ENSRNOG00000025037: 77%
Entrez Gene ID: 255239
Uniprot ID: Q8NFD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER
• Gene Sequence: EVNEDISQELMDSDSGNYLKRALQLSDRKNLVPRDEELCIYENKVTPLHFLVAQGSVEQVRLLLAHEVDVDCQTASGYTPLLIAAQDQQPDLCALLLAHGADANRVDEDGWAPLHFAAQNGDDGTARLLLDHGACVDAQER
• Gene ID - Mouse: ENSMUSG00000032257
• Gene ID - Rat: ENSRNOG00000025037
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.