Anti ANKIB1 pAb (ATL-HPA021780)

Atlas Antibodies

Catalog No.:
ATL-HPA021780-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and IBR domain containing 1
Gene Name: ANKIB1
Alternative Gene Name: DKFZP434A0225, KIAA1386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040351: 77%, ENSRNOG00000005502: 77%
Entrez Gene ID: 54467
Uniprot ID: Q9P2G1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEGVKDVELVLPEDSMFEDASVSEGRGTQIEENPLEENILAGEAASQAGDSGNEAANRGDGSDVSSQTPQTSSDWLEQV
Gene Sequence QDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEGVKDVELVLPEDSMFEDASVSEGRGTQIEENPLEENILAGEAASQAGDSGNEAANRGDGSDVSSQTPQTSSDWLEQV
Gene ID - Mouse ENSMUSG00000040351
Gene ID - Rat ENSRNOG00000005502
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKIB1 pAb (ATL-HPA021780)
Datasheet Anti ANKIB1 pAb (ATL-HPA021780) Datasheet (External Link)
Vendor Page Anti ANKIB1 pAb (ATL-HPA021780) at Atlas Antibodies

Documents & Links for Anti ANKIB1 pAb (ATL-HPA021780)
Datasheet Anti ANKIB1 pAb (ATL-HPA021780) Datasheet (External Link)
Vendor Page Anti ANKIB1 pAb (ATL-HPA021780)