Anti ANKIB1 pAb (ATL-HPA021780)

Atlas Antibodies

SKU:
ATL-HPA021780-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
  • Western blot analysis in human cell line WM-115.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and IBR domain containing 1
Gene Name: ANKIB1
Alternative Gene Name: DKFZP434A0225, KIAA1386
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040351: 77%, ENSRNOG00000005502: 77%
Entrez Gene ID: 54467
Uniprot ID: Q9P2G1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEGVKDVELVLPEDSMFEDASVSEGRGTQIEENPLEENILAGEAASQAGDSGNEAANRGDGSDVSSQTPQTSSDWLEQV
Gene Sequence QDPNINDNLLGNIMAWFHDMNPQSIALIPPATTEISADSQLPCIKDGSEGVKDVELVLPEDSMFEDASVSEGRGTQIEENPLEENILAGEAASQAGDSGNEAANRGDGSDVSSQTPQTSSDWLEQV
Gene ID - Mouse ENSMUSG00000040351
Gene ID - Rat ENSRNOG00000005502
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANKIB1 pAb (ATL-HPA021780)
Datasheet Anti ANKIB1 pAb (ATL-HPA021780) Datasheet (External Link)
Vendor Page Anti ANKIB1 pAb (ATL-HPA021780) at Atlas Antibodies

Documents & Links for Anti ANKIB1 pAb (ATL-HPA021780)
Datasheet Anti ANKIB1 pAb (ATL-HPA021780) Datasheet (External Link)
Vendor Page Anti ANKIB1 pAb (ATL-HPA021780)