Anti ANKFY1 pAb (ATL-HPA024522)

Atlas Antibodies

Catalog No.:
ATL-HPA024522-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and FYVE domain containing 1
Gene Name: ANKFY1
Alternative Gene Name: ANKHZN, BTBD23, KIAA1255, ZFYVE14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020790: 95%, ENSRNOG00000016212: 95%
Entrez Gene ID: 51479
Uniprot ID: Q9P2R3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYEC
Gene Sequence SPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYEC
Gene ID - Mouse ENSMUSG00000020790
Gene ID - Rat ENSRNOG00000016212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKFY1 pAb (ATL-HPA024522)
Datasheet Anti ANKFY1 pAb (ATL-HPA024522) Datasheet (External Link)
Vendor Page Anti ANKFY1 pAb (ATL-HPA024522) at Atlas Antibodies

Documents & Links for Anti ANKFY1 pAb (ATL-HPA024522)
Datasheet Anti ANKFY1 pAb (ATL-HPA024522) Datasheet (External Link)
Vendor Page Anti ANKFY1 pAb (ATL-HPA024522)