Anti ANKFY1 pAb (ATL-HPA024522)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024522-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ANKFY1
Alternative Gene Name: ANKHZN, BTBD23, KIAA1255, ZFYVE14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020790: 95%, ENSRNOG00000016212: 95%
Entrez Gene ID: 51479
Uniprot ID: Q9P2R3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYEC |
| Gene Sequence | SPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYEC |
| Gene ID - Mouse | ENSMUSG00000020790 |
| Gene ID - Rat | ENSRNOG00000016212 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKFY1 pAb (ATL-HPA024522) | |
| Datasheet | Anti ANKFY1 pAb (ATL-HPA024522) Datasheet (External Link) |
| Vendor Page | Anti ANKFY1 pAb (ATL-HPA024522) at Atlas Antibodies |
| Documents & Links for Anti ANKFY1 pAb (ATL-HPA024522) | |
| Datasheet | Anti ANKFY1 pAb (ATL-HPA024522) Datasheet (External Link) |
| Vendor Page | Anti ANKFY1 pAb (ATL-HPA024522) |