Anti ANKFY1 pAb (ATL-HPA024522)

Atlas Antibodies

Catalog No.: ATL-HPA024522-25

Protein Description: ankyrin repeat and FYVE domain containing 1
Gene Name: ANKFY1
Alternative Gene Name: ANKHZN, BTBD23, KIAA1255, ZFYVE14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020790: 95%, ENSRNOG00000016212: 95%
Entrez Gene ID: 51479
Uniprot ID: Q9P2R3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYEC
• Gene Sequence: SPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYEC
• Gene ID - Mouse: ENSMUSG00000020790
• Gene ID - Rat: ENSRNOG00000016212
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.