Anti ANKFN1 pAb (ATL-HPA022538)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022538-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ANKFN1
Alternative Gene Name: FLJ38335
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047773: 93%, ENSRNOG00000022893: 26%
Entrez Gene ID: 162282
Uniprot ID: Q8N957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSGSESMESVDHTSDCPMQLFFYELQMAVKALLQQINIPLHQARNFRLYTQEVLEMGHNVSFLLLLPASDDVCTAPGQNNPYTPHSGFLN |
| Gene Sequence | LSGSESMESVDHTSDCPMQLFFYELQMAVKALLQQINIPLHQARNFRLYTQEVLEMGHNVSFLLLLPASDDVCTAPGQNNPYTPHSGFLN |
| Gene ID - Mouse | ENSMUSG00000047773 |
| Gene ID - Rat | ENSRNOG00000022893 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANKFN1 pAb (ATL-HPA022538) | |
| Datasheet | Anti ANKFN1 pAb (ATL-HPA022538) Datasheet (External Link) |
| Vendor Page | Anti ANKFN1 pAb (ATL-HPA022538) at Atlas Antibodies |
| Documents & Links for Anti ANKFN1 pAb (ATL-HPA022538) | |
| Datasheet | Anti ANKFN1 pAb (ATL-HPA022538) Datasheet (External Link) |
| Vendor Page | Anti ANKFN1 pAb (ATL-HPA022538) |