Anti ANKDD1B pAb (ATL-HPA059722)

Atlas Antibodies

Catalog No.: ATL-HPA059722-25

Protein Description: ankyrin repeat and death domain containing 1B
Gene Name: ANKDD1B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047117: 79%, ENSRNOG00000025377: 81%
Entrez Gene ID: 728780
Uniprot ID: A6NHY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGHVEMIEKLTFLNLHTSE
• Gene Sequence: ATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGHVEMIEKLTFLNLHTSE
• Gene ID - Mouse: ENSMUSG00000047117
• Gene ID - Rat: ENSRNOG00000025377
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.