Anti ANKDD1B pAb (ATL-HPA059722)

Atlas Antibodies

Catalog No.:
ATL-HPA059722-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and death domain containing 1B
Gene Name: ANKDD1B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047117: 79%, ENSRNOG00000025377: 81%
Entrez Gene ID: 728780
Uniprot ID: A6NHY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGHVEMIEKLTFLNLHTSE
Gene Sequence ATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGHVEMIEKLTFLNLHTSE
Gene ID - Mouse ENSMUSG00000047117
Gene ID - Rat ENSRNOG00000025377
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANKDD1B pAb (ATL-HPA059722)
Datasheet Anti ANKDD1B pAb (ATL-HPA059722) Datasheet (External Link)
Vendor Page Anti ANKDD1B pAb (ATL-HPA059722) at Atlas Antibodies

Documents & Links for Anti ANKDD1B pAb (ATL-HPA059722)
Datasheet Anti ANKDD1B pAb (ATL-HPA059722) Datasheet (External Link)
Vendor Page Anti ANKDD1B pAb (ATL-HPA059722)