Anti ANKDD1B pAb (ATL-HPA059722)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059722-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ANKDD1B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047117: 79%, ENSRNOG00000025377: 81%
Entrez Gene ID: 728780
Uniprot ID: A6NHY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGHVEMIEKLTFLNLHTSE |
Gene Sequence | ATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGHVEMIEKLTFLNLHTSE |
Gene ID - Mouse | ENSMUSG00000047117 |
Gene ID - Rat | ENSRNOG00000025377 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANKDD1B pAb (ATL-HPA059722) | |
Datasheet | Anti ANKDD1B pAb (ATL-HPA059722) Datasheet (External Link) |
Vendor Page | Anti ANKDD1B pAb (ATL-HPA059722) at Atlas Antibodies |
Documents & Links for Anti ANKDD1B pAb (ATL-HPA059722) | |
Datasheet | Anti ANKDD1B pAb (ATL-HPA059722) Datasheet (External Link) |
Vendor Page | Anti ANKDD1B pAb (ATL-HPA059722) |