Anti ANKDD1A pAb (ATL-HPA040757)

Atlas Antibodies

SKU: ATL-HPA040757-25

• 
• 

Protein Description: ankyrin repeat and death domain containing 1A
Gene Name: ANKDD1A
Alternative Gene Name: FLJ25870
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066510: 73%, ENSRNOG00000015554: 66%
Entrez Gene ID: 348094
Uniprot ID: Q495B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTALHSAAGGSHPDCVQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVRHNFPALVRLLINSDSDVNAV
• Gene Sequence: LTALHSAAGGSHPDCVQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHAGGCANVVDHQGASPLHLAVRHNFPALVRLLINSDSDVNAV
• Gene ID - Mouse: ENSMUSG00000066510
• Gene ID - Rat: ENSRNOG00000015554
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.