Anti ANK3 pAb (ATL-HPA038455)

Atlas Antibodies

Catalog No.:
ATL-HPA038455-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ankyrin 3, node of Ranvier (ankyrin G)
Gene Name: ANK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069601: 82%, ENSRNOG00000053288: 83%
Entrez Gene ID: 288
Uniprot ID: Q12955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ENNVFHDPVDGWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQ
Gene Sequence ENNVFHDPVDGWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQ
Gene ID - Mouse ENSMUSG00000069601
Gene ID - Rat ENSRNOG00000053288
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANK3 pAb (ATL-HPA038455)
Datasheet Anti ANK3 pAb (ATL-HPA038455) Datasheet (External Link)
Vendor Page Anti ANK3 pAb (ATL-HPA038455) at Atlas Antibodies

Documents & Links for Anti ANK3 pAb (ATL-HPA038455)
Datasheet Anti ANK3 pAb (ATL-HPA038455) Datasheet (External Link)
Vendor Page Anti ANK3 pAb (ATL-HPA038455)