Anti ANK3 pAb (ATL-HPA038455)

Atlas Antibodies

Catalog No.: ATL-HPA038455-25

Protein Description: ankyrin 3, node of Ranvier (ankyrin G)
Gene Name: ANK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069601: 82%, ENSRNOG00000053288: 83%
Entrez Gene ID: 288
Uniprot ID: Q12955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENNVFHDPVDGWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQ
• Gene Sequence: ENNVFHDPVDGWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQ
• Gene ID - Mouse: ENSMUSG00000069601
• Gene ID - Rat: ENSRNOG00000053288
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.