Anti ANK1 pAb (ATL-HPA056953)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056953-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ANK1
Alternative Gene Name: ANK, SPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031543: 90%, ENSRNOG00000018241: 83%
Entrez Gene ID: 286
Uniprot ID: P16157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP |
| Gene Sequence | FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP |
| Gene ID - Mouse | ENSMUSG00000031543 |
| Gene ID - Rat | ENSRNOG00000018241 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ANK1 pAb (ATL-HPA056953) | |
| Datasheet | Anti ANK1 pAb (ATL-HPA056953) Datasheet (External Link) |
| Vendor Page | Anti ANK1 pAb (ATL-HPA056953) at Atlas Antibodies |
| Documents & Links for Anti ANK1 pAb (ATL-HPA056953) | |
| Datasheet | Anti ANK1 pAb (ATL-HPA056953) Datasheet (External Link) |
| Vendor Page | Anti ANK1 pAb (ATL-HPA056953) |
| Citations for Anti ANK1 pAb (ATL-HPA056953) – 1 Found |
| Hall, A E; Lu, W-T; Godfrey, J D; Antonov, A V; Paicu, C; Moxon, S; Dalmay, T; Wilczynska, A; Muller, P A J; Bushell, M. The cytoskeleton adaptor protein ankyrin-1 is upregulated by p53 following DNA damage and alters cell migration. Cell Death & Disease. 2016;7(4):e2184. PubMed |