Anti ANK1 pAb (ATL-HPA056953)

Atlas Antibodies

Catalog No.:
ATL-HPA056953-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ankyrin 1, erythrocytic
Gene Name: ANK1
Alternative Gene Name: ANK, SPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031543: 90%, ENSRNOG00000018241: 83%
Entrez Gene ID: 286
Uniprot ID: P16157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP
Gene Sequence FVLVSDKHRMSFPETVDEILDVSEDEGEELISFKAERRDSRDVDEEKELLDFVPKLDQVVESPAIPRIPCAMPETVVIRSEEQEQASKEYDEDSLIPSSP
Gene ID - Mouse ENSMUSG00000031543
Gene ID - Rat ENSRNOG00000018241
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANK1 pAb (ATL-HPA056953)
Datasheet Anti ANK1 pAb (ATL-HPA056953) Datasheet (External Link)
Vendor Page Anti ANK1 pAb (ATL-HPA056953) at Atlas Antibodies

Documents & Links for Anti ANK1 pAb (ATL-HPA056953)
Datasheet Anti ANK1 pAb (ATL-HPA056953) Datasheet (External Link)
Vendor Page Anti ANK1 pAb (ATL-HPA056953)
Citations for Anti ANK1 pAb (ATL-HPA056953) – 1 Found
Hall, A E; Lu, W-T; Godfrey, J D; Antonov, A V; Paicu, C; Moxon, S; Dalmay, T; Wilczynska, A; Muller, P A J; Bushell, M. The cytoskeleton adaptor protein ankyrin-1 is upregulated by p53 following DNA damage and alters cell migration. Cell Death & Disease. 2016;7(4):e2184.  PubMed