Anti ANGPTL5 pAb (ATL-HPA038516)

Atlas Antibodies

Catalog No.:
ATL-HPA038516-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: angiopoietin-like 5
Gene Name: ANGPTL5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029671: 27%, ENSRNOG00000004444: 24%
Entrez Gene ID: 253935
Uniprot ID: Q86XS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQ
Gene Sequence HHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQ
Gene ID - Mouse ENSMUSG00000029671
Gene ID - Rat ENSRNOG00000004444
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANGPTL5 pAb (ATL-HPA038516)
Datasheet Anti ANGPTL5 pAb (ATL-HPA038516) Datasheet (External Link)
Vendor Page Anti ANGPTL5 pAb (ATL-HPA038516) at Atlas Antibodies

Documents & Links for Anti ANGPTL5 pAb (ATL-HPA038516)
Datasheet Anti ANGPTL5 pAb (ATL-HPA038516) Datasheet (External Link)
Vendor Page Anti ANGPTL5 pAb (ATL-HPA038516)