Anti ANGPTL3 pAb (ATL-HPA038097)

Atlas Antibodies

SKU:
ATL-HPA038097-25
  • Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: angiopoietin-like 3
Gene Name: ANGPTL3
Alternative Gene Name: ANGPT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028553: 91%, ENSRNOG00000008638: 90%
Entrez Gene ID: 27329
Uniprot ID: Q9Y5C1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRT
Gene Sequence QDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRT
Gene ID - Mouse ENSMUSG00000028553
Gene ID - Rat ENSRNOG00000008638
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANGPTL3 pAb (ATL-HPA038097)
Datasheet Anti ANGPTL3 pAb (ATL-HPA038097) Datasheet (External Link)
Vendor Page Anti ANGPTL3 pAb (ATL-HPA038097) at Atlas Antibodies

Documents & Links for Anti ANGPTL3 pAb (ATL-HPA038097)
Datasheet Anti ANGPTL3 pAb (ATL-HPA038097) Datasheet (External Link)
Vendor Page Anti ANGPTL3 pAb (ATL-HPA038097)