Anti ANGPTL2 pAb (ATL-HPA041299)

Atlas Antibodies

Catalog No.:
ATL-HPA041299-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: angiopoietin-like 2
Gene Name: ANGPTL2
Alternative Gene Name: ARP2, HARP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004105: 94%, ENSRNOG00000016678: 94%
Entrez Gene ID: 23452
Uniprot ID: Q9UKU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVP
Gene Sequence QLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVP
Gene ID - Mouse ENSMUSG00000004105
Gene ID - Rat ENSRNOG00000016678
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANGPTL2 pAb (ATL-HPA041299)
Datasheet Anti ANGPTL2 pAb (ATL-HPA041299) Datasheet (External Link)
Vendor Page Anti ANGPTL2 pAb (ATL-HPA041299) at Atlas Antibodies

Documents & Links for Anti ANGPTL2 pAb (ATL-HPA041299)
Datasheet Anti ANGPTL2 pAb (ATL-HPA041299) Datasheet (External Link)
Vendor Page Anti ANGPTL2 pAb (ATL-HPA041299)