Anti ANGEL2 pAb (ATL-HPA030796)

Atlas Antibodies

Catalog No.:
ATL-HPA030796-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: angel homolog 2 (Drosophila)
Gene Name: ANGEL2
Alternative Gene Name: Ccr4d, FLJ12793, KIAA0759L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026634: 90%, ENSRNOG00000003795: 92%
Entrez Gene ID: 90806
Uniprot ID: Q5VTE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFPDTGIPEVTTCHSRSAITVDYIFYSAEKEDVAGHPGAEVALVGGLKLLARLSLLTEQDLWTVNGLPNENNSSDHLPLLAKFRLEL
Gene Sequence YFPDTGIPEVTTCHSRSAITVDYIFYSAEKEDVAGHPGAEVALVGGLKLLARLSLLTEQDLWTVNGLPNENNSSDHLPLLAKFRLEL
Gene ID - Mouse ENSMUSG00000026634
Gene ID - Rat ENSRNOG00000003795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANGEL2 pAb (ATL-HPA030796)
Datasheet Anti ANGEL2 pAb (ATL-HPA030796) Datasheet (External Link)
Vendor Page Anti ANGEL2 pAb (ATL-HPA030796) at Atlas Antibodies

Documents & Links for Anti ANGEL2 pAb (ATL-HPA030796)
Datasheet Anti ANGEL2 pAb (ATL-HPA030796) Datasheet (External Link)
Vendor Page Anti ANGEL2 pAb (ATL-HPA030796)