Anti ANG pAb (ATL-HPA055896)

Atlas Antibodies

Catalog No.:
ATL-HPA055896-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: angiogenin
Gene Name: ANG
Alternative Gene Name: RAA1, RNASE5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072115: 73%, ENSRNOG00000025562: 73%
Entrez Gene ID: 283
Uniprot ID: P03950
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGN
Gene Sequence QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGN
Gene ID - Mouse ENSMUSG00000072115
Gene ID - Rat ENSRNOG00000025562
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANG pAb (ATL-HPA055896)
Datasheet Anti ANG pAb (ATL-HPA055896) Datasheet (External Link)
Vendor Page Anti ANG pAb (ATL-HPA055896) at Atlas Antibodies

Documents & Links for Anti ANG pAb (ATL-HPA055896)
Datasheet Anti ANG pAb (ATL-HPA055896) Datasheet (External Link)
Vendor Page Anti ANG pAb (ATL-HPA055896)