Anti ANG pAb (ATL-HPA055896)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055896-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ANG
Alternative Gene Name: RAA1, RNASE5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072115: 73%, ENSRNOG00000025562: 73%
Entrez Gene ID: 283
Uniprot ID: P03950
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGN |
Gene Sequence | QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGN |
Gene ID - Mouse | ENSMUSG00000072115 |
Gene ID - Rat | ENSRNOG00000025562 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ANG pAb (ATL-HPA055896) | |
Datasheet | Anti ANG pAb (ATL-HPA055896) Datasheet (External Link) |
Vendor Page | Anti ANG pAb (ATL-HPA055896) at Atlas Antibodies |
Documents & Links for Anti ANG pAb (ATL-HPA055896) | |
Datasheet | Anti ANG pAb (ATL-HPA055896) Datasheet (External Link) |
Vendor Page | Anti ANG pAb (ATL-HPA055896) |