Anti ANAPC5 pAb (ATL-HPA039457)

Atlas Antibodies

Catalog No.:
ATL-HPA039457-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: anaphase promoting complex subunit 5
Gene Name: ANAPC5
Alternative Gene Name: APC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029472: 98%, ENSRNOG00000001316: 98%
Entrez Gene ID: 51433
Uniprot ID: Q9UJX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen LSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLR
Gene Sequence LSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLR
Gene ID - Mouse ENSMUSG00000029472
Gene ID - Rat ENSRNOG00000001316
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ANAPC5 pAb (ATL-HPA039457)
Datasheet Anti ANAPC5 pAb (ATL-HPA039457) Datasheet (External Link)
Vendor Page Anti ANAPC5 pAb (ATL-HPA039457) at Atlas Antibodies

Documents & Links for Anti ANAPC5 pAb (ATL-HPA039457)
Datasheet Anti ANAPC5 pAb (ATL-HPA039457) Datasheet (External Link)
Vendor Page Anti ANAPC5 pAb (ATL-HPA039457)