Anti ANAPC5 pAb (ATL-HPA039457)

Atlas Antibodies

Catalog No.: ATL-HPA039457-25

Protein Description: anaphase promoting complex subunit 5
Gene Name: ANAPC5
Alternative Gene Name: APC5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029472: 98%, ENSRNOG00000001316: 98%
Entrez Gene ID: 51433
Uniprot ID: Q9UJX4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLR
• Gene Sequence: LSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLR
• Gene ID - Mouse: ENSMUSG00000029472
• Gene ID - Rat: ENSRNOG00000001316
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.