Anti ANAPC4 pAb (ATL-HPA038396)

Atlas Antibodies

SKU:
ATL-HPA038396-25
  • Immunohistochemical staining of human stomach shows moderate nuclear positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: anaphase promoting complex subunit 4
Gene Name: ANAPC4
Alternative Gene Name: APC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029176: 100%, ENSRNOG00000004130: 100%
Entrez Gene ID: 29945
Uniprot ID: Q9UJX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQN
Gene Sequence WLYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLKDEDDDLVSPPNTEGNQWYDFLQN
Gene ID - Mouse ENSMUSG00000029176
Gene ID - Rat ENSRNOG00000004130
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANAPC4 pAb (ATL-HPA038396)
Datasheet Anti ANAPC4 pAb (ATL-HPA038396) Datasheet (External Link)
Vendor Page Anti ANAPC4 pAb (ATL-HPA038396) at Atlas Antibodies

Documents & Links for Anti ANAPC4 pAb (ATL-HPA038396)
Datasheet Anti ANAPC4 pAb (ATL-HPA038396) Datasheet (External Link)
Vendor Page Anti ANAPC4 pAb (ATL-HPA038396)