Anti ANAPC10 pAb (ATL-HPA044547)

Atlas Antibodies

SKU:
ATL-HPA044547-25
  • Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: anaphase promoting complex subunit 10
Gene Name: ANAPC10
Alternative Gene Name: APC10, DKFZP564L0562, DOC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036977: 100%, ENSRNOG00000018296: 100%
Entrez Gene ID: 10393
Uniprot ID: Q9UM13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSI
Gene Sequence HNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSI
Gene ID - Mouse ENSMUSG00000036977
Gene ID - Rat ENSRNOG00000018296
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANAPC10 pAb (ATL-HPA044547)
Datasheet Anti ANAPC10 pAb (ATL-HPA044547) Datasheet (External Link)
Vendor Page Anti ANAPC10 pAb (ATL-HPA044547) at Atlas Antibodies

Documents & Links for Anti ANAPC10 pAb (ATL-HPA044547)
Datasheet Anti ANAPC10 pAb (ATL-HPA044547) Datasheet (External Link)
Vendor Page Anti ANAPC10 pAb (ATL-HPA044547)