Anti ANAPC1 pAb (ATL-HPA042998)

Atlas Antibodies

SKU:
ATL-HPA042998-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: anaphase promoting complex subunit 1
Gene Name: ANAPC1
Alternative Gene Name: APC1, MCPR, TSG24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014355: 94%, ENSRNOG00000016965: 95%
Entrez Gene ID: 64682
Uniprot ID: Q9H1A4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSV
Gene Sequence DLSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETISAFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSV
Gene ID - Mouse ENSMUSG00000014355
Gene ID - Rat ENSRNOG00000016965
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ANAPC1 pAb (ATL-HPA042998)
Datasheet Anti ANAPC1 pAb (ATL-HPA042998) Datasheet (External Link)
Vendor Page Anti ANAPC1 pAb (ATL-HPA042998) at Atlas Antibodies

Documents & Links for Anti ANAPC1 pAb (ATL-HPA042998)
Datasheet Anti ANAPC1 pAb (ATL-HPA042998) Datasheet (External Link)
Vendor Page Anti ANAPC1 pAb (ATL-HPA042998)