Anti AMZ1 pAb (ATL-HPA020233)

Atlas Antibodies

Catalog No.:
ATL-HPA020233-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: archaelysin family metallopeptidase 1
Gene Name: AMZ1
Alternative Gene Name: KIAA1950
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050022: 62%, ENSRNOG00000024264: 67%
Entrez Gene ID: 155185
Uniprot ID: Q400G9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIKEHERWLAMCIQALQREVAEEDLVQVDRAVDALDRWEMFTGQLPATRQDPPSSRDSVGLRKVLGDKFSSLRRKLSARKLARAESAPRPWDG
Gene Sequence AIKEHERWLAMCIQALQREVAEEDLVQVDRAVDALDRWEMFTGQLPATRQDPPSSRDSVGLRKVLGDKFSSLRRKLSARKLARAESAPRPWDG
Gene ID - Mouse ENSMUSG00000050022
Gene ID - Rat ENSRNOG00000024264
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMZ1 pAb (ATL-HPA020233)
Datasheet Anti AMZ1 pAb (ATL-HPA020233) Datasheet (External Link)
Vendor Page Anti AMZ1 pAb (ATL-HPA020233) at Atlas Antibodies

Documents & Links for Anti AMZ1 pAb (ATL-HPA020233)
Datasheet Anti AMZ1 pAb (ATL-HPA020233) Datasheet (External Link)
Vendor Page Anti AMZ1 pAb (ATL-HPA020233)