Anti AMY1A pAb (ATL-HPA045399)

Atlas Antibodies

Catalog No.:
ATL-HPA045399-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: amylase, alpha 1A (salivary)
Gene Name: AMY1A
Alternative Gene Name: AMY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096770: 92%, ENSRNOG00000055613: 92%
Entrez Gene ID: 276
Uniprot ID: P04745
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
Gene Sequence KPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
Gene ID - Mouse ENSMUSG00000096770
Gene ID - Rat ENSRNOG00000055613
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMY1A pAb (ATL-HPA045399)
Datasheet Anti AMY1A pAb (ATL-HPA045399) Datasheet (External Link)
Vendor Page Anti AMY1A pAb (ATL-HPA045399) at Atlas Antibodies

Documents & Links for Anti AMY1A pAb (ATL-HPA045399)
Datasheet Anti AMY1A pAb (ATL-HPA045399) Datasheet (External Link)
Vendor Page Anti AMY1A pAb (ATL-HPA045399)