Anti AMY1A pAb (ATL-HPA045394)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045394-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AMY1A
Alternative Gene Name: AMY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074264: 88%, ENSRNOG00000055613: 87%
Entrez Gene ID: 276
Uniprot ID: P04745
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
Gene Sequence | SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
Gene ID - Mouse | ENSMUSG00000074264 |
Gene ID - Rat | ENSRNOG00000055613 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AMY1A pAb (ATL-HPA045394) | |
Datasheet | Anti AMY1A pAb (ATL-HPA045394) Datasheet (External Link) |
Vendor Page | Anti AMY1A pAb (ATL-HPA045394) at Atlas Antibodies |
Documents & Links for Anti AMY1A pAb (ATL-HPA045394) | |
Datasheet | Anti AMY1A pAb (ATL-HPA045394) Datasheet (External Link) |
Vendor Page | Anti AMY1A pAb (ATL-HPA045394) |
Citations for Anti AMY1A pAb (ATL-HPA045394) – 2 Found |
Granlund, Louise; Hedin, Anders; Wahlhütter, Miriam; Seiron, Peter; Korsgren, Olle; Skog, Oskar; Lundberg, Marcus. Histological and transcriptional characterization of the pancreatic acinar tissue in type 1 diabetes. Bmj Open Diabetes Research & Care. 2021;9(1) PubMed |
Saitou, Marie; Gaylord, Eliza A; Xu, Erica; May, Alison J; Neznanova, Lubov; Nathan, Sara; Grawe, Anissa; Chang, Jolie; Ryan, William; Ruhl, Stefan; Knox, Sarah M; Gokcumen, Omer. Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva. Cell Reports. 2020;33(7):108402. PubMed |