Anti AMY1A pAb (ATL-HPA045394)

Atlas Antibodies

Catalog No.:
ATL-HPA045394-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: amylase, alpha 1A (salivary)
Gene Name: AMY1A
Alternative Gene Name: AMY1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074264: 88%, ENSRNOG00000055613: 87%
Entrez Gene ID: 276
Uniprot ID: P04745
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Gene Sequence SLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Gene ID - Mouse ENSMUSG00000074264
Gene ID - Rat ENSRNOG00000055613
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMY1A pAb (ATL-HPA045394)
Datasheet Anti AMY1A pAb (ATL-HPA045394) Datasheet (External Link)
Vendor Page Anti AMY1A pAb (ATL-HPA045394) at Atlas Antibodies

Documents & Links for Anti AMY1A pAb (ATL-HPA045394)
Datasheet Anti AMY1A pAb (ATL-HPA045394) Datasheet (External Link)
Vendor Page Anti AMY1A pAb (ATL-HPA045394)
Citations for Anti AMY1A pAb (ATL-HPA045394) – 2 Found
Granlund, Louise; Hedin, Anders; Wahlhütter, Miriam; Seiron, Peter; Korsgren, Olle; Skog, Oskar; Lundberg, Marcus. Histological and transcriptional characterization of the pancreatic acinar tissue in type 1 diabetes. Bmj Open Diabetes Research & Care. 2021;9(1)  PubMed
Saitou, Marie; Gaylord, Eliza A; Xu, Erica; May, Alison J; Neznanova, Lubov; Nathan, Sara; Grawe, Anissa; Chang, Jolie; Ryan, William; Ruhl, Stefan; Knox, Sarah M; Gokcumen, Omer. Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva. Cell Reports. 2020;33(7):108402.  PubMed